![](/images/graphics-bg.png)
Effects of Muscarinic Acetylcholine 3 Receptor208-227 Peptide Immunization on Autoimmune Response in Nonobese Diabetic Mice
المؤلفون المشاركون
Pang, Chunyan
Lv, Fengfeng
Zhang, Wei
Ju, Jinzhe
Wang, Yongfu
Yang, Lin
Yang, Guoan
المصدر
Clinical and Developmental Immunology
العدد
المجلد 2013، العدد 2013 (31 ديسمبر/كانون الأول 2013)، ص ص. 1-10، 10ص.
الناشر
Hindawi Publishing Corporation
تاريخ النشر
2013-12-09
دولة النشر
مصر
عدد الصفحات
10
التخصصات الرئيسية
الملخص EN
The second extracellular loop (LFWQYFVGKRTVPPGECFIQFLSEPTITFGTAI, aa 205–237) of muscarinic acetylcholine 3 receptor (M3R) has been reported to be an epitope for autoantibodies generated during certain autoimmune disorders, including Sjögren’s syndrome (SS).
Autoantibodies against M3R228–237 have been shown to interfere with the function of M3R.
However, few studies have been performed on the M3R205–227 peptide of the second extracellular loop.
In the current study, we sought to investigate the effect of M3R208–227 peptide immunization on autoimmune response in NOD/LtJ mice.
We synthesized the M3R208–227 peptide and immunized NOD/LtJ mice to investigate whether peptide-specific antibodies could be generated and whether immunization would lead to changes in autoimmune response in NOD/LtJ mice.
Our results demonstrate that the secretions of Th-1, Th-2, and Th-17 cytokines are downregulated and lymphocytic infiltration is improved in the salivary glands and lacrimal glands following immunization with M3R208–227 peptide in NOD/LtJ mice, suggesting that peptide immunotherapy using the M3R208–227 peptide may represent a potential therapeutic alternative.
نمط استشهاد جمعية علماء النفس الأمريكية (APA)
Yang, Lin& Ju, Jinzhe& Zhang, Wei& Lv, Fengfeng& Pang, Chunyan& Yang, Guoan…[et al.]. 2013. Effects of Muscarinic Acetylcholine 3 Receptor208-227 Peptide Immunization on Autoimmune Response in Nonobese Diabetic Mice. Clinical and Developmental Immunology،Vol. 2013, no. 2013, pp.1-10.
https://search.emarefa.net/detail/BIM-475364
نمط استشهاد الجمعية الأمريكية للغات الحديثة (MLA)
Yang, Lin…[et al.]. Effects of Muscarinic Acetylcholine 3 Receptor208-227 Peptide Immunization on Autoimmune Response in Nonobese Diabetic Mice. Clinical and Developmental Immunology No. 2013 (2013), pp.1-10.
https://search.emarefa.net/detail/BIM-475364
نمط استشهاد الجمعية الطبية الأمريكية (AMA)
Yang, Lin& Ju, Jinzhe& Zhang, Wei& Lv, Fengfeng& Pang, Chunyan& Yang, Guoan…[et al.]. Effects of Muscarinic Acetylcholine 3 Receptor208-227 Peptide Immunization on Autoimmune Response in Nonobese Diabetic Mice. Clinical and Developmental Immunology. 2013. Vol. 2013, no. 2013, pp.1-10.
https://search.emarefa.net/detail/BIM-475364
نوع البيانات
مقالات
لغة النص
الإنجليزية
الملاحظات
Includes bibliographical references
رقم السجل
BIM-475364
قاعدة معامل التأثير والاستشهادات المرجعية العربي "ارسيف Arcif"
أضخم قاعدة بيانات عربية للاستشهادات المرجعية للمجلات العلمية المحكمة الصادرة في العالم العربي
![](/images/ebook-kashef.png)
تقوم هذه الخدمة بالتحقق من التشابه أو الانتحال في الأبحاث والمقالات العلمية والأطروحات الجامعية والكتب والأبحاث باللغة العربية، وتحديد درجة التشابه أو أصالة الأعمال البحثية وحماية ملكيتها الفكرية. تعرف اكثر
![](/images/kashef-image.png)