In Silico Characterization of Histidine Acid Phytase Sequences
المؤلفون المشاركون
Verma, A. K.
Kumar, Vinod
Agrawal, Sanjeev
Singh, Gopal
المصدر
العدد
المجلد 2012، العدد 2012 (31 ديسمبر/كانون الأول 2012)، ص ص. 1-8، 8ص.
الناشر
Hindawi Publishing Corporation
تاريخ النشر
2012-12-05
دولة النشر
مصر
عدد الصفحات
8
التخصصات الرئيسية
الملخص EN
Histidine acid phytases (HAPhy) are widely distributed enzymes among bacteria, fungi, plants, and some animal tissues.
They have a significant role as an animal feed enzyme and in the solubilization of insoluble phosphates and minerals present in the form of phytic acid complex.
A set of 50 reference protein sequences representing HAPhy were retrieved from NCBI protein database and characterized for various biochemical properties, multiple sequence alignment (MSA), homology search, phylogenetic analysis, motifs, and superfamily search.
MSA using MEGA5 revealed the presence of conserved sequences at N-terminal “RHGXRXP” and C-terminal “HD.” Phylogenetic tree analysis indicates the presence of three clusters representing different HAPhy, that is, PhyA, PhyB, and AppA.
Analysis of 10 commonly distributed motifs in the sequences indicates the presence of signature sequence for each class.
Motif 1 “SPFCDLFTHEEWIQYDYLQSLGKYYGYGAGNPLGPAQGIGF” was present in 38 protein sequences representing clusters 1 (PhyA) and 2 (PhyB).
Cluster 3 (AppA) contains motif 9 “KKGCPQSGQVAIIADVDERTRKTGEAFAAGLAPDCAITVHTQADTSSPDP” as a signature sequence.
All sequences belong to histidine acid phosphatase family as resulted from superfamily search.
No conserved sequence representing 3- or 6-phytase could be identified using multiple sequence alignment.
This in silico analysis might contribute in the classification and future genetic engineering of this most diverse class of phytase.
نمط استشهاد جمعية علماء النفس الأمريكية (APA)
Kumar, Vinod& Singh, Gopal& Verma, A. K.& Agrawal, Sanjeev. 2012. In Silico Characterization of Histidine Acid Phytase Sequences. Enzyme Research،Vol. 2012, no. 2012, pp.1-8.
https://search.emarefa.net/detail/BIM-502807
نمط استشهاد الجمعية الأمريكية للغات الحديثة (MLA)
Kumar, Vinod…[et al.]. In Silico Characterization of Histidine Acid Phytase Sequences. Enzyme Research No. 2012 (2012), pp.1-8.
https://search.emarefa.net/detail/BIM-502807
نمط استشهاد الجمعية الطبية الأمريكية (AMA)
Kumar, Vinod& Singh, Gopal& Verma, A. K.& Agrawal, Sanjeev. In Silico Characterization of Histidine Acid Phytase Sequences. Enzyme Research. 2012. Vol. 2012, no. 2012, pp.1-8.
https://search.emarefa.net/detail/BIM-502807
نوع البيانات
مقالات
لغة النص
الإنجليزية
الملاحظات
Includes bibliographical references
رقم السجل
BIM-502807
قاعدة معامل التأثير والاستشهادات المرجعية العربي "ارسيف Arcif"
أضخم قاعدة بيانات عربية للاستشهادات المرجعية للمجلات العلمية المحكمة الصادرة في العالم العربي
تقوم هذه الخدمة بالتحقق من التشابه أو الانتحال في الأبحاث والمقالات العلمية والأطروحات الجامعية والكتب والأبحاث باللغة العربية، وتحديد درجة التشابه أو أصالة الأعمال البحثية وحماية ملكيتها الفكرية. تعرف اكثر